Rating:
0/5.0 scores (Votes: 0)
askpattycertifiedfemalefriendly.com

Askpattycertifiedfemalefriendly.com

Certifed Female Friendly Around Dallas, TX | Certified Female Friendly

Added: 2015-04-01 00:00:00 (9 years, 23 days, 10 hours ago)

Askpattycertifiedfemalefriendly.com is ranked #187,520 among the most popular web sites, the lower the rank indicator the more popular is the web site and the more visitors it has. Askpattycertifiedfemalefriendly.com is registered in 2009-07-14 owned by AskPatty.com, Inc., website’s age 14 years, 9 months, 10 days years. The number of unique users visiting this website every day is 2,362. Each individual visits 1.13 unique pages per day. Approximate time spent on a web site 01:21. It has 1,408 backlinks according to Alexa. Askpattycertifiedfemalefriendly.com daily advertisement revenue is $47 USD. According to our analysis the approximate value of the website is $17,006 US Dollars. Most popular search engine request "tracking devices for cars". Website’s IP address is 50.57.77.13 which is hosted by Rackspace Hosting, site server is located in San Antonio TX in United States. Google PageRank™ of the website is 3 of 10. Askpattycertifiedfemalefriendly.com reputation rank is of 100. Average time of a website’s page load is 3.01667 seconds. The web site is not listed in DMOZ open directory project.

Traffic

2,362
visitors/daily

Revenue

$47 USD
daily

Worth

$17,006 USD
total

Overview Information about Askpattycertifiedfemalefriendly.com
Title askpattycertifiedfemalefriendly.com Certifed Female Friendly Around Dallas, TX | Certified Female Friendly
Alexa Rank #187,520
Alexa Backlinks 1,408
Estimated Daily Traffic 2,362 visitors
Estimated Daily Revenue $47.24 USD
Website Worth $17,006.40 USD
Domain Name Askpattycertifiedfemalefriendly.com
Domain Created 2009-07-14 (14 years, 9 months, 10 days ago)
Domain Expires 2012-07-14 (in 11 years, 9 months, 10 days)
Domain Registrar ENOM, INC.
Domain Owner AskPatty.com, Inc.
Domain Nameservers dns1.name-services.com (98.124.192.1)
dns2.name-services.com (98.124.197.1)
dns3.name-services.com (98.124.193.1)
dns4.name-services.com (98.124.194.1)
dns5.name-services.com (98.124.196.1)
Google Analytics ID UA-744271
Google PageRank™ Google PageRank - Askpattycertifiedfemalefriendly.com Copy & paste this code at your website:
Yahoo Indexed
6 pages
Bing Indexed
1 pages
Average Load Time 3.02 second(s)
Server IPs 50.57.77.13
Server Provider Rackspace Hosting
Server Location us United States, San Antonio
Auto Web Pinger

Are you an owner of this website? Place our automatic pinging button on your site and it will be automatically pinged when you press this button.

Copy & paste this code at your website

Traffic Analysis for Askpattycertifiedfemalefriendly.com

Askpattycertifiedfemalefriendly.com is visited by around 2,362 unique visitors per day. Every visitor of this website viewing approximately 1.13 pages per day.

Website Reputation Analysis for Askpattycertifiedfemalefriendly.com

Using information from users, and other reliable sources, Askpattycertifiedfemalefriendly.com has the reputation 100 out of 100.

Website Reputation
  • Trustworthiness is NA points. Shows general level of users trust for this website.
  • Vendor reliability is NA points. This shows the trust level for business operations on the website.
  • Privacy is NA points. The trust level for protection of users privacy.
  • Child Safety is NA points. Trust level for its availability for children.
HTML Markup & Content Analysis for Askpattycertifiedfemalefriendly.com

Main HTML elements that might affect on search engines ranking.

<H1> Tags: 0 <H2> Tags: 0
<H3> Tags: 0 <H4> Tags: 0
<H5> Tags: 0 <H6> Tags: 0
IFrames: 0 Flash: No
Total Links: 0 Total Images: 0
Language: English Text/Html Ratio: -
Doctype: No Microformats: Not found
Top Keywords from Search Engines for Askpattycertifiedfemalefriendly.com

The top queries driving traffic to Askpattycertifiedfemalefriendly.com from search engines.

Query Search Traffic
lifespan twins 3.84%
oranges bad for teeth 1.91%
essi viding 1.47%
huttworks reenel associates 1.39%
what is mechanical turk 1.21%
carrington event 0.89%
damage flaxseed 0.67%
low latent inhibition 0.62%
ctl plants online 0.55%
tracking devices for cars 0.52%
High Impact Search Queries for Askpattycertifiedfemalefriendly.com

High impact keywords that attract search engine traffic.

Visitors by Country for Askpattycertifiedfemalefriendly.com

Visitor's map indicates that Askpattycertifiedfemalefriendly.com has 2,362 daily visitors from 5 countries, 70.90% of visitors come from United States United States.

Server Information for Askpattycertifiedfemalefriendly.com

Detailed information about the server that hosts Askpattycertifiedfemalefriendly.com

Server IPs: 50.57.77.13
Server Name: Apache/2.2.17 (Ubuntu)
Server Provider: Rackspace Hosting
Server Location: San Antonio TX in United States us
Charset: UTF-8
Powered By: PHP/5.3.5-1ubuntu7.7
Average Load Time: 3.02 second(s)
Geographical Location of the Server

Server located: San Antonio TX in United States us

The IP address of Askpattycertifiedfemalefriendly.com is 50.57.77.13.

HTTP Headers for Askpattycertifiedfemalefriendly.com

From the HTTP headers of Askpattycertifiedfemalefriendly.com, you will know that HTTP status code is HTTP/1.1 200 OK, server name is Apache/2.2.17 (Ubuntu).

HTTP/1.1 200 OK
Date : Sat, 07 Apr 2012 05:09:23 GMT
Server : Apache/2.2.17 (Ubuntu)
X-Powered-By : PHP/5.3.5-1ubuntu7.7
Set-Cookie : session=c6gpa859nqmlumupbcqcie5m82; path=/
Content-Encoding : gzip
Vary : Accept-Encoding
Content-Length : 5646
Content-Type : text/html; charset=utf-8
Social Media Analysis for Askpattycertifiedfemalefriendly.com

Links (even if they have nofollow attributes) from major social networks is a "human" signal for search engines, which has some influence (non-determining influence) on the position of your website in search results.

  • This website is mentioned in Facebook social networking service 0 times.
  • This website is mentioned in Google+ social networking service 0 times.
  • This website is mentioned in Twitter microblogging service 0 times.
  • This website is mentioned in Pinterest online pinboard 0 times.
  • This website is mentioned in Delicious social bookmarking service 0 times.
  • This website is mentioned in LinkedIn social networking service 0 times.
Indexed Pages in Search Engines of Askpattycertifiedfemalefriendly.com

The chart shows how Askpattycertifiedfemalefriendly.com indexed in major search engines.

  • Google indexed 0 pages. The maximum value is 0, the minimum value is 0, while the average value is 0.
  • Yahoo indexed 6 pages. The maximum value is 0, the minimum value is 0, while the average value is 0.
  • Bing indexed 1 pages. The maximum value is 0, the minimum value is 0, while the average value is 0.
Google PageRank™ Analysis for Askpattycertifiedfemalefriendly.com

PageRank™ is a link analysis algorithm used by Google™.

Google™ assigned this website a Pagerank of 3. The maximum value is 0, the minimum value is 0, while the average value is 0.

W3C HTML Validation Analysis

The W3C Markup Validation Service is a validator by the World Wide Web Consortium (W3C), which allows Internet users to check HTML and XHTML documents for well-formed markup.

  • This website has 0 Error(s). The maximum value is 0, the minimum value is 0, while the average value is 0.
  • This website has 0 Warning(s). The maximum value is 0, the minimum value is 0, while the average value is 0.
  • Validation details: W3C HTML Validation.
Reviews and Comments about Askpattycertifiedfemalefriendly.com